Skip to content
Department of Health and Human ServicesNational Institutes of HealthNational Heart Lung and Blood Institute
mTAL Phosphoproteome Database
NHLBI Division of Intramural ResearchLaboratory of Kidney and Electrolyte Metabolism

The mTAL Phosphoproteome Database (mTAL-PD) contains phosphoprotein mass spectrometry data from native renal medullary thick ascending limb (mTAL) enriched tubule suspensions.

Experiment description:
Large-scale quantitative phosphoproteomic profiling was performed on paired vehicle- and hormone-treated mTAL-enriched suspensions. The samples were analyzed on an LTQ-Orbitrap mass spectrometer and the resulting MS spectra were searched using three search algorithms: SEQUEST, InsPecT, and OMSSA. In all cases, a target-decoy analysis approach was undertaken to limit the false discovery rate to < 2%. Phosphorylation site assignment was carried out using the following scoring algorithms: Ascore and PhosphoScore for SEQUEST data, and Phosphate Localization Score for InsPecT data. In order to assign a phosphorylation site correctly, at least one score had to pass the given threshold (Ascore = 19, PhosphoScore was "Passed" or "OneChoice" PLS score = 8). Final assignment of phosphorylation sites was performed using the in-house programs, NHLBI Promatch and Phosphosite. Quantification of phosphopeptide abundance (area under the curve of the reconstructed ion chromatogram elution profile) was achieved using QUOIL, an in-house software program designed for quantification of label-free peptides by LC-MS (NHLBI Proteomics Core Facility). As a result, 654 unique phosphopeptides corresponding to 374 unique phosphoproteins were identified.

Description of data format:
The peptide sequence, phosphorylation site(s), and the corresponding protein name, gene symbol, and RefSeq accession number are reported for each phosphopeptide identified in either of three independent experiments. For those phosphopeptides that could be quantified in all three experiments, the mean Log2 (Hormone/Vehicle) abundance ratio and corresponding standard error are also reported.

Peptide Sequence column: * = phosphorylated residue

Site(s) column: ^ = ambiguously assigned phosphorylation site

Log2(H/V) Mean and SE columns: H = hormone-treated, V = vehicle-treated, n/a = peptide not observable in all 3 replicates

Sig. column: * = significantly changed Log2(H/V), p<0.05; ‡= |Log2(H/V)|>0.58

The mTAL-PD was created by Ruwan Gunaratne, Guozhong Ma, Trairak Pisitkun, and Mark A. Knepper. Contact us with questions or comments at knepperm@nhlbi.nih.gov.

Reference:
Gunaratne R, Braucht DW, Rinschen MM, Chou CL, Hoffert JD, Pisitkun T, Knepper MA. Quantitative phosphoproteomic analysis reveals cAMP/vasopressin-dependent signaling pathways in native renal thick ascending limb cells. Proc Natl Acad Sci U S A. 2010 Aug 16. [Epub ahead of print]

Click here to download data in Excel formatExcel File (File size: 201 KB).

Click Table Column Header to Sort
Gene SymbolProtein NameRefseq AccessionPeptide SequenceSite(s)Log2(H/V)MeanLog2(H/V)SESig
Aak1AP2- associated protein kinase 1NP_001166921VGSLT*PPSS*PKT622^, S626^0.240.95
Abca12PREDICTED: ATP- binding cassette, sub- family A (ABC1), member 12XP_237242GLVQVLS*FFSQVQQQRS251^1.242.13
Abcc10multidrug resistance- associated protein 7NP_001101671LMT*ELLS*GIRVLKT464, S468- 2.682.48
Abcf1ATP- binding cassette sub- family F member 1NP_001103353QLSVPAS*DEEDEVPVPVPRS109n/an/a
Ablim1actin- binding LIM protein 1NP_001037859PGSSIPGS*PGHTIYAKS51- 3.551.82
Ablim1actin- binding LIM protein 1NP_001037859RSS*GREEDEEELLRS236n/an/a
Ablim1actin- binding LIM protein 1NP_001037859S*SGREEDEEELLRS235^n/an/a
Ablim1actin- binding LIM protein 1NP_001037859SGLHRPVS*TDFAQYNSYGDVSGGVRS318^1.431.17
Ablim1actin- binding LIM protein 1NP_001037859SGLHRPVST*DFAQYNSYGDVSGGVRT319^1.191.24
Ablim1actin- binding LIM protein 1NP_001037859STS*QGSINSPVYSRS1360.450.09*
Ablim1actin- binding LIM protein 1NP_001037859T*LSPTPSAEGFQDGRT113^n/an/a
Ablim1actin- binding LIM protein 1NP_001037859T*SSESIYSRPGSSIPGS*PGHTIYAKT35^, S51^n/an/a
Ablim1actin- binding LIM protein 1NP_001037859TLS*PTPSAEGFQDGRS115- 0.130.13
Ablim1actin- binding LIM protein 1NP_001037859TSS*ESIYSRPGSSIPGSPGHTIYAKS37^n/an/a
Ablim1actin- binding LIM protein 1NP_001037859TSSESIYSRPGSSIPGS*PGHTIYAKS51^n/an/a
Abp10PREDICTED: annexin V- binding protein ABP- 10XP_001060944KLS*SQPSTDISTDKERS237- 6.363.15
Acin1apoptotic chromatin condensation inducer 1NP_001163939GLS*PLSSTADTKS4793.683.76
Acss2acetyl- coenzyme A synthetase, cytoplasmicNP_001101263VRGWS*PPPEVRS30- 0.620.15
Adcy6adenylate cyclase type 6NP_036953NVEPPS*PTPAARS53- 0.951.15
Adcy6adenylate cyclase type 6NP_036953NVEPPSPT*PAART55^- 0.301.60
Add1alpha- adducinNP_058686SPPDQSAVPNT*PPS*TPVKT610, S613^n/an/a
Add1alpha- adducinNP_058686SPPDQSAVPNT*PPS*TPVKLEGGLPQEPTSRT610, S613^n/an/a
Add1alpha- adducinNP_058686SPPDQSAVPNT*PPST*PVKT610^, T614^n/an/a
Add1alpha- adducinNP_058686SPPDQSAVPNT*PPST*PVKLEGGLPQEPTSRT610, T614^n/an/a
Add1alpha- adducinNP_058686VVTS*PPPTTAPHKS12n/an/a
Add1alpha- adducinNP_058686YSDVEVPASVTGHSFASDGDS*GTCSPLRS427- 0.210.17
Add1alpha- adducinNP_058686YSDVEVPASVTGHSFASDGDSGTCS*PLRS431- 0.930.53
Add3gamma- adducin isoform 2NP_113740DRTEEVLSPDGSPSKS*PSKS648- 0.730.16*‡
Add3gamma- adducin isoform 2NP_113740DRTEEVLSPDGSPSKSPS*KS650^n/an/a
Add3gamma- adducin isoform 2NP_113740TEEVLSPDGS*PSKSPSKS644^n/an/a
Add3gamma- adducin isoform 2NP_113740TEEVLSPDGSPSKS*PSKS648- 0.342.45
AhnakPREDICTED: AHNAK nucleoproteinXP_574618EFSAPST*PTGTLEFAGGEGKT2934n/an/a
AhnakPREDICTED: AHNAK nucleoproteinXP_574618FKAEAALPS*PKS2257- 0.670.15*‡
AhnakPREDICTED: AHNAK nucleoprotein isoform 1XP_001078032KGDRS*PEPGQTWAHEVFSSRS94- 0.190.10
AhnakPREDICTED: AHNAK nucleoprotein isoform 1XP_001078032KGDRSPEPGQT*WAHEVFSSRT100^- 0.420.42
Ahsgalpha- 2- HS- glycoprotein precursorNP_037030VLHAQCHSTPDS*AEDVRS138- 1.000.99
Ahsgalpha- 2- HS- glycoprotein precursorNP_037030VLHAQCHSTPDS*AEDVRKS138n/an/a
Akap12A- kinase anchor protein 12 isoform alphaNP_476444S*PSWISASVTEPLEHTAGEAMPPVEEVTEKS890^n/an/a
Akap12A- kinase anchor protein 12 isoform alphaNP_476444TEPASEEQEPAEDTDQARLS*ADYEKS350^n/an/a
Akap12A- kinase anchor protein 12 isoform alphaNP_476444TEPASEEQEPAEDTDQARLSADY*EKY353^n/an/a
Akap2A- kinase anchor protein 2NP_001011974TLS*MIEEEIRS7300.410.32
Aldoal1aldolase A- like 1NP_001013965LQS*IGTENTEENRS46n/an/a
Aldoal1aldolase A- like 1NP_001013965KELSDIAHRIVAPGKGILAADES*TGSIAKS36^n/an/a
Ank2PREDICTED: ankyrin 2, neuronalXP_342338AS*PIVQEPEEASEPKS1726n/an/a
Ank3ankyrin 3, epithelial isoform 2NP_001029156AEEPVS*PLTAYQKS2544- 0.310.10
Ank3ankyrin 3, epithelial isoform 2NP_001029156LSDGEYIS*DGEEGEDAITGDTDKYLGPQDLKS875n/an/a
Ank3ankyrin 3, epithelial isoform 2NP_001029156MNVPETMNEVLDMS*DDEVGKS8550.430.13
Ank3ankyrin 3, epithelial isoform 2NP_001029156RIT*GGLLDRT24652.640.45*‡
Ank3ankyrin 3, epithelial isoform 2NP_001029156RQS*FTSLALRS14580.880.20*‡
Ank3ankyrin 3, epithelial isoform 2NP_001029156SFADENNVFHDPVDGWQNETPSGSLES*PAQARS2457- 0.520.12*
Ankhd1- Eif4ebp3PREDICTED: multiple ankyrin repeats, single KH- domain homologXP_001054207AVTT*T*S*KT1619^, T1620^, S1621^n/an/a
Ankrd12ankyrin repeat domain- containing protein 12NP_001101708S*STGEGSS*KTQHEKS972^, S979^n/an/a
Ankrd12ankyrin repeat domain- containing protein 12NP_001101708SST*GEGSS*KTQHEKT974^, S979^n/an/a
Ankrd54ankyrin repeat domain- containing protein 54NP_001020456S*KLNILQEGHS*QCLEAVRLEVKQIIHMLRS217, S2270.571.07
Ap2a2AP- 2 complex subunit alpha- 2NP_112270EMAEAFAGEIPKILVAGDT*MDS*VKT160, S163n/an/a
Ap3d1AP- 3 complex subunit delta- 1NP_001094189NAETVKS*PEKEGVPGVEKS8251.852.05
Ap3d1AP- 3 complex subunit delta- 1NP_001094189VDIITEEMPENALPS*DEDDKDPNDPYRS784n/an/a
Apbb1amyloid beta A4 precursor protein- binding family B member 1NP_536726INGALES*VLSSS*SRS569^, S574^n/an/a
Apoc2apolipoprotein C- IINP_001078821AAAGELYQKTY*LTSVDEKLRDMY*S*KY60^, Y72^, S73^n/an/a
Aqp1aquaporin- 1NP_036910VWT*SGQVEEYDLDADDINSRT246^1.290.42
Aqp1aquaporin- 1NP_036910VWTSGQVEEYDLDADDINS*RS2621.350.57
Aqp1aquaporin- 1NP_036910VWTSGQVEEYDLDADDINS*RVEMKPKS262- 0.601.51
Aqp2aquaporin- 2NP_037041RQS*VELHS*PQSLPRS256, S2611.051.10
Aqp2aquaporin- 2NP_037041RQS*VELHSPQS*LPRS256, S2642.672.64
Aqp2aquaporin- 2NP_037041RQS*VELHSPQSLPRS2561.600.17*‡
Aqp2aquaporin- 2NP_037041RQSVELHS*PQS*LPRS261^, S264^2.001.98
Aqp2aquaporin- 2NP_037041RQSVELHS*PQSLPRS261n/an/a
Aqp2aquaporin- 2NP_037041RRQS*VELHS*PQSLPRS256, S261n/an/a
Aqp2aquaporin- 2NP_037041RRQS*VELHSPQSLPRS2561.700.24*‡
Arfgap2ADP- ribosylation factor GTPase- activating protein 2NP_001028879HGTDLWIDNMNSAPSHS*PEKS145n/an/a
Arfgef2brefeldin A- inhibited guanine nucleotide- exchange protein 2NP_851597ELEKPIQSKPQS*PVIQATAGS*PKS218, S227- 0.900.12*‡
Arfgef2brefeldin A- inhibited guanine nucleotide- exchange protein 2NP_851597ELEKPIQSKPQSPVIQATAGS*PKS227n/an/a
Arhgap24rho GTPase- activating protein 24NP_001012032RCS*WDKPESPQRS283^- 0.701.44
Arhgef11rho guanine nucleotide exchange factor 11NP_076472S*SCTAEKS509n/an/a
Arhgef12rho guanine nucleotide exchange factor 12NP_001013264VEHHDLSVAGLQS*PDRS1176^n/an/a
Arl6ip6ADP- ribosylation factor- like protein 6- interacting protein 6NP_001019481IGDGS*PVLPDKRS770.330.46
Armc10armadillo repeat- containing protein 10NP_001100046S*AEDLTEGSYDAILSAEQLEKS43^n/an/a
Atp1a1sodium/potassium- transporting ATPase subunit alpha- 1 precursorNP_036636S*PDFTNENPLETRS2281.821.74
Atp1a3sodium/potassium- transporting ATPase subunit alpha- 3NP_036638VDNSS*LTGESEPQTRS207^n/an/a
Atxn2lataxin 2- likeNP_001123569EVDGLLTSDPMGS*PVSSKS3470.681.38
B3gnt7UDP- GlcNAc:betaGal beta- 1, 3- N- acetylglucosaminyltransferase 7NP_001012134KKDNKYY*IPAVMYSKY279^0.972.04
Badbcl2 antagonist of cell deathNP_073189RMS*DEFEGSFKS1560.971.80
Bckdha2- oxoisovalerate dehydrogenase subunit alpha, mitochondrialNP_036914IGHHS*TSDDSSAYRS338^n/an/a
Bckdha2- oxoisovalerate dehydrogenase subunit alpha, mitochondrialNP_036914IGHHS*TSDDSSAYRS*VDEVNYWDKS338^, S348^0.470.62
Bckdha2- oxoisovalerate dehydrogenase subunit alpha, mitochondrialNP_036914IGHHST*SDDSSAYRT339^n/an/a
Bckdha2- oxoisovalerate dehydrogenase subunit alpha, mitochondrialNP_036914IGHHSTS*DDSSAYRS340n/an/a
Bckdha2- oxoisovalerate dehydrogenase subunit alpha, mitochondrialNP_036914S*VDEVNYWDKS3480.680.54
Bckdha2- oxoisovalerate dehydrogenase subunit alpha, mitochondrialNP_036914S*VDEVNYWDKQDHPISRS3481.882.45
Bckdk[3- methyl- 2- oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial precursorNP_062117S*TSATDTHHVELARS31^n/an/a
Bckdk[3- methyl- 2- oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial precursorNP_062117ST*SATDTHHVELART32^n/an/a
Bckdk[3- methyl- 2- oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial precursorNP_062117STS*ATDTHHVELARS33^n/an/a
Bclaf1bcl- 2- associated transcription factor 1NP_001041317FHDS*EGDDTEETEDYRS397n/an/a
Bclaf1bcl- 2- associated transcription factor 1NP_001041317IDIS*PSALRS6580.500.51
Bclaf1bcl- 2- associated transcription factor 1NP_001041317LKELFDYS*PPLHKS512^- 0.130.14
Bclaf1bcl- 2- associated transcription factor 1NP_001041317RIDISPS*ALRS660- 0.730.42
Bclaf1bcl- 2- associated transcription factor 1NP_001041317YS*PSQNS*PIHHIPSRS284, S289- 3.554.58
Bclaf1bcl- 2- associated transcription factor 1NP_001041317YS*PSQNSPIHHIPSRS284^- 0.040.27
BsndbarttinNP_620435LWEEAAYDQS*LPDFTHIQMKS107- 0.550.96
BsndbarttinNP_620435MKEETVQAGAEEPEQEEEDLYYGLPDS*PGDPLPDKS290n/an/a
BsndbarttinNP_620435S*PPDRDEAHLQVPWASRS206^- 0.200.23
BsndbarttinNP_620435S*PQPSPPDRDEAHLQVPWASRS202^- 0.250.33
BsndbarttinNP_620435SQSS*PPACSQGSAPLASFHDDLDVGSSEGRS175^n/an/a
CadCAD proteinNP_001099180IHRAS*DPGLPAEEPKS18590.400.09*
Camta2calmodulin- binding transcription activator 2NP_001099271KDGY*LWKKRY121n/an/a
Canxcalnexin precursorNP_742005AEEDEILNRS*PRS5820.370.66
Carhsp1calcium- regulated heat stable protein 1NP_690003TFS*ATVRS520.370.76
Carhsp1calcium- regulated heat stable protein 1NP_690003TFSAT*VRT540.671.23
Cbx5chromobox protein homolog 5NP_001100267KSS*FSNSADDIKS933.182.78
Ccar1cell division cycle and apoptosis regulator protein 1NP_001102005NLS*TVMDDIHTVLKKS1117^n/an/a
Cdk5rap2CDK5 regulatory subunit- associated protein 2NP_775157AVEKHYKSLPGESS*SKFHSQEQVVKS467^1.481.76
Cgnl1cingulin- like protein 1NP_001101634EGVGEETLS*PRS251- 0.500.82
Cgnl1cingulin- like protein 1NP_001101634NCFPKPCGS*QPNS*PTPEDLAKS198, S202^n/an/a
Cgnl1cingulin- like protein 1NP_001101634NCFPKPCGSQPNS*PTPEDLAKS2021.521.77
Cgnl1cingulin- like protein 1NP_001101634RKS*PTAPS*PQAYSETKS256, S261- 0.510.75
Cgnl1cingulin- like protein 1NP_001101634RKS*PTAPS*PQAYSETKKS256, S2612.870.56*‡
Cgnl1cingulin- like protein 1NP_001101634RKS*PTAPSPQAYSETKS256- 0.400.50
Cgnl1cingulin- like protein 1NP_001101634RKS*PTAPSPQAYSETKKS256n/an/a
Cgnl1cingulin- like protein 1NP_001101634RKSPT*APS*PQAYSETKKT258, S2613.190.74*‡
Cgnl1cingulin- like protein 1NP_001101634RKSPT*APSPQAYSETKT258^2.462.30
Cgnl1cingulin- like protein 1NP_001101634RQDS*AGPILDGARS2831.151.28
Cgnl1cingulin- like protein 1NP_001101634S*PTAPSPQAYSETKS256^n/an/a
Cgnl1cingulin- like protein 1NP_001101634S*SEHLLRPSQVFLQRS413^- 0.070.11
Cgnl1cingulin- like protein 1NP_001101634SRS*VDSAFPFGLQGNTEYLTEFSRS387^- 3.953.30
Cgnl1cingulin- like protein 1NP_001101634SS*EHLLRPSQVFLQRS414- 0.080.11
Clasp2CLIP- associating protein 2NP_446174GRSRTKMVS*QSQPGS*RS459, S465n/an/a
Cldn10claudin 10NP_001099528MGYTYNGPTS*VMSSRS256n/an/a
ClmncalminNP_001100225SHSEEGLDFKPS*PPLSKS722- 0.280.14
ClmncalminNP_001100225SHSEEGLDFKPSPPLS*KS726^- 0.380.23
ClmncalminNP_001100225VFVCDQLES*PTGFSLGSAPSHKS358n/an/a
Cobll1Cobl- like 1NP_001101203ASPES*PSEDSSAQPPAAIQDGKS1151.651.73
Cobll1Cobl- like 1NP_001101203ASPESPS*EDSSAQPPAAIQDGKS117^n/an/a
Cobll1Cobl- like 1NP_001101203QSS*LNFQSSDPEHIRS180- 0.140.03
Comtcatechol O- methyltransferaseNP_036663AIYQGPSS*PDKSS260^n/an/a
Coq9ubiquinone biosynthesis protein COQ9, mitochondrial precursorNP_001030334YTDQS*GEEEEDYESEEQIQHRS80n/an/a
Cpeb1cytoplasmic polyadenylation element- binding protein 1NP_001099746SY*LKAVT*AAFVEIKTTKFTKY483^, T488^n/an/a
Ctdspl2CTD small phosphatase- like protein 2NP_001014070KYS*EVDDSLPSGGEKPSKS28^1.160.83
Ctnna1catenin alpha- 1NP_001007146TPEELDDS*DFETEDFDVRS643n/an/a
Ctnna1catenin alpha- 1NP_001007146SRTS*VQTEDDQLIAGQSARS657n/an/a
Ctnnb1catenin beta- 1NP_445809RLS*VELTSSLFRS675- 0.380.81
Ctnnb1catenin beta- 1NP_445809RTS*MGGTQQQFVEGVRS5522.150.15*‡
Ctnnb1catenin beta- 1NP_445809T*SMGGTQQQFVEGVRT551^2.040.46*‡
Ctnnb1catenin beta- 1NP_445809TS*MGGTQQQFVEGVRS552^2.040.46*‡
Ctnnd1catenin delta- 1NP_001101210LRS*YEDMIGEEVPPDQYYWAPLAQHERS3200.470.43
Ctnnd1catenin delta- 1NP_001101210S*MGYDDLDYGMMSDYGTARS288^n/an/a
Ctnnd1catenin delta- 1NP_001101210S*RQDVYGPQPQVRS252^- 2.470.95
Ctnnd1catenin delta- 1NP_001101210VGGS*SVDLHRS2682.142.79
Cttncortactin isoform BNP_068640KQT*PPAS*PSPQPAEDRPPS*SPIYEDAAPLKT364, S368^, S380^n/an/a
Cttncortactin isoform BNP_068640KQT*PPAS*PSPQPAEDRPPSSPIY*EDAAPLKT364, S368, Y384^n/an/a
Cttncortactin isoform BNP_068640KQT*PPASPSPQPAEDRPPS*SPIYEDAAPLKT364^, S380^n/an/a
Cttncortactin isoform BNP_068640KQT*PPASPSPQPAEDRPPSSPIY*EDAAPLKT364, Y384^n/an/a
Cul1cullin- 1NP_001102097LIEKERNGETINT*RT198^0.460.10*
Cybacytochrome b- 245 light chainNP_077074KKPS*EAEEEAASAGGPQVNPIPVTDEVVS1681.340.26*‡
Cys1cystin 1NP_001103067TAAVQEECGPDPRPAT*PPGGRT551.512.15
Cys1cystin 1NP_001103067VTGNPEDSCASEAPGSS*PKS116- 1.622.33
Dapdeath- associated protein 1NP_071971DKDDQEWESTS*PPKPTVYISGVIARS51^- 0.490.50
Dbnldrebrin- like proteinNP_112642LRS*PFLQKS288- 0.530.11*
Ddi2protein DDI1 homolog 2NP_001029321TQAQLLS*PGERS1215.155.04
Disc1disrupted in schizophrenia 1 homologNP_783186LLALSS*RNTRRLGS*VKS623^, S631^- 0.770.17*‡
Dixdc1dixinNP_001032743QAY*VAWVNAQLKKY31n/an/a
Dnajc5dnaJ homolog subfamily C member 5NP_077075SLS*TSGESLYHVLGLDKS100.770.39
Dnm1ldynamin- 1- like proteinNP_446107SKPIPIMPAS*PQKS596- 0.330.74
Dock8dedicator of cytokinesis 8NP_001032882VMSSS*NPDLAGTHCAADEEVKS904^n/an/a
Dtnbdystrobrevin betaNP_001012191VLDS*PSRLDEEHRS394n/an/a
Dync1h1cytoplasmic dynein 1 heavy chain 1NP_062099TDSTS*DGRPAWMRS4368^- 0.200.18
Dync1li1cytoplasmic dynein 1 light intermediate chain 1NP_665715DFQEYVEPGEDFPAS*PQRS207n/an/a
Dync1li1cytoplasmic dynein 1 light intermediate chain 1NP_665715KPASVS*PTTPPS*PTEGEASS510, S516^n/an/a
Dync1li1cytoplasmic dynein 1 light intermediate chain 1NP_665715KPASVSPTTPPS*PTEGEASS516n/an/a
Dync1li1cytoplasmic dynein 1 light intermediate chain 1NP_665715KPASVSPTTPPSPT*EGEAST518^n/an/a
Dyrk1bdual specificity tyrosine- phosphorylation- regulated kinase 1BNP_001100966IYQY*IQSRY2730.581.00
Edc4enhancer of mRNA- decapping protein 4NP_001028240TRS*PDVISSASTALSQDIPEIASEALSRS734^4.685.16
Eef1delongation factor 1- deltaNP_001013122GATPAEDDEDNDIDLFGS*DEEEEDKEAARS531n/an/a
Egfpro- epidermal growth factor precursorNP_036974KDDQILAGDNADLS*KEVASLDNSPKS799- 0.230.14
Ehbp1l1EH domain- binding protein 1- like protein 1 isoform 1NP_001020288LKPKS*VKVVHAELS*LTLS*GVLLREGRS141^, S150^, S154^0.970.98
Eif3beukaryotic translation initiation factor 3 subunit BNP_001026810AKPAAQSEEETAAS*PAAS*PTPQSAQEPSAPGKS75, S79n/an/a
Eif3beukaryotic translation initiation factor 3 subunit BNP_001026810AKPAAQSEEETAAS*PAASPT*PQSAQEPSAPGKS75^, T81^n/an/a
Eif3ceukaryotic translation initiation factor 3 subunit CNP_001094132LLLS*EDEEDTKRS39^- 0.220.38
Eif4beukaryotic translation initiation factor 4BNP_001008325SLENETLNKEEDCHS*PTSKPPKPDQPLKS459- 1.350.07*‡
Eif4g2eukaryotic translation initiation factor 4 gamma, 2NP_001017374FDKLCLELLNVGVES*KS1071.232.18
Eif5beukaryotic translation initiation factor 5BNP_001103611SVPTIDS*GNEDDDSSFKS215n/an/a
Epb4.1PREDICTED: erythrocyte membrane protein band 4.1XP_232771RLS*THSPFRS890^0.961.09
Epb4.1l1band 4.1- like protein 1 isoform LNP_067713SLDGAEFSRPAS*VSENHDAGPDGDKRS441- 0.150.57
Epb4.9dematinNP_001101855DSSVPGS*PSNIVAKS262.602.42
Epb4.9dematinNP_001101855DSSVPGSPS*NIVAKS281.811.64
Epb4.9dematinNP_001101855STS*PPPS*PEVWAESRS92, S96n/an/a
Epn3epsin- 3NP_001019962TPVLPSGPPITDPWAPSSPT*PKT3611.451.46
Eps15l1epidermal growth factor receptor substrate 15- like 1NP_001025092STPSHGSVSSLNSTGSLS*PKS255n/an/a
Eps8l2epidermal growth factor receptor kinase substrate 8- like protein 2NP_001101978HS*LSSEPQVPEDVAPPGSSPHANRS421^n/an/a
Eps8l2epidermal growth factor receptor kinase substrate 8- like protein 2NP_001101978HSLS*SEPQVPEDVAPPGSSPHANRS423^n/an/a
Eps8l2epidermal growth factor receptor kinase substrate 8- like protein 2NP_001101978HSLSSEPQVPEDVAPPGS*SPHANRS437n/an/a
Eps8l2epidermal growth factor receptor kinase substrate 8- like protein 2NP_001101978HSLSSEPQVPEDVAPPGSS*PHANRS438- 0.190.10
Eps8l2epidermal growth factor receptor kinase substrate 8- like protein 2NP_001101978RAEDSYSNVHTS*PEAEGAPHLS675n/an/a
Eps8l2epidermal growth factor receptor kinase substrate 8- like protein 2NP_001101978YWGPAS*PTHKS5280.821.32
Eps8l2epidermal growth factor receptor kinase substrate 8- like protein 2NP_001101978YWGPASPT*HKT530^- 0.830.47
Erbb2receptor tyrosine- protein kinase erbB- 2NP_058699RHRSSS*TRS1055n/an/a
Esamendothelial cell- selective adhesion molecule precursorNP_001004245AAPPRPGTFTPTPSVSSQALS*SPRS347^- 2.991.81
Esamendothelial cell- selective adhesion molecule precursorNP_001004245AAPPRPGTFTPTPSVSSQALSS*PRS348- 1.080.20*‡
Exosc2exosome complex exonuclease RRP4NP_001102422Y*GKLGQGALVQVSPALVKY163- 0.991.34
Fam129bniban- like protein 1NP_001103355TVLEAS*PPAS*PLRS693, S6970.840.48
Fam169aPREDICTED: family with sequence similarity 169, member AXP_226706TILGS*SDNVATLSNEEKS5220.170.43
Fam21cWASH complex subunit FAM21NP_954677GQPAQGPVSEES*PPSPKPGKS384^0.000.55
Fam21cWASH complex subunit FAM21NP_954677TS*PDSEQPPASEPVWERPWSVEEIRS5^n/an/a
Fam54bhypothetical protein LOC298549NP_001013957AS*FETLPNISDLCLKS384.830.60*‡
Fam54bhypothetical protein LOC298549NP_001013957ASS*FADMMGILKS2350.520.47
Fam54bhypothetical protein LOC298549NP_001013957NAS*VPNLRS1001.541.60
Fam82a2regulator of microtubule dynamics protein 3NP_001014068S*QSLPNSLDYAQTSERS441.180.06*‡
Fam82a2regulator of microtubule dynamics protein 3NP_001014068SQS*LPNSLDYAQTSERS46^1.180.06
Farp1FERM, RhoGEF and pleckstrin domain- containing protein 1NP_001100757LGAPENSGIS*TLERS233.123.08
Farp1FERM, RhoGEF and pleckstrin domain- containing protein 1NP_001100757LGAPENSGIST*LERT243.113.08
Farp1FERM, RhoGEF and pleckstrin domain- containing protein 1NP_001100757SPDEATAADQES*EDDLSASRS893n/an/a
Fcho2PREDICTED: Fcho2 isoform 2XP_219503LSGINEIPRPFS*PPITSNTS*PPPTAPLARS533, S541^n/an/a
Fkbp15PREDICTED: FK506 binding protein 15XP_342847RLS*LTPDPEKKS1094^2.242.50
Fkbp2peptidyl- prolyl cis- trans isomerase FKBP2NP_001127900VDHCPIKS*RS44n/an/a
Fkbp8peptidyl- prolyl cis- trans isomerase FKBP8NP_001032257LEPS*NKTIHAELSKLVKS329n/an/a
Flnafilamin- ANP_001128071RAPS*VANVGSHCDLSLKS21440.270.17
Fnbp1lformin- binding protein 1- likeNP_001034698RHS*SDINHLVTQGRS4881.750.45
Foxp1forkhead box protein P1NP_001029303ERLQAMMT*HLHVKSTEPKAAPQPLNLVS*S*VTLSKT401, S421, S422^0.671.03
G3bp1GTPase activating protein (SH3 domain) binding protein 1NP_598249SAS*PAPADVAPAQEDLRS2310.170.27
G3bp1GTPase activating protein (SH3 domain) binding protein 1NP_598249YQDEVFGGFVTEPQEES*EEEVEEPEERS149 ^n/an/a
Gbf1PREDICTED: golgi- specific brefeldin A- resistance factor 1XP_219953ADAPDAGAQSDS*ELPSYHQNDVSLDRS1301^n/an/a
GckglucokinaseNP_036697VMLVKVGEGEAGQWS*VKTKS100^- 0.570.11*
GckglucokinaseNP_036697VMLVKVGEGEAGQWSVKT*KT103^- 0.570.12*
Gng12PREDICTED: guanine nucleotide binding protein (G protein), gamma 12XP_001067408ASADLMS*YCEEHARSDPLLMGIPTSENPFKS41^0.380.24
Gng12PREDICTED: guanine nucleotide binding protein (G protein), gamma 12XP_001067408S*DPLLMGIPTSENPFKS490.630.14*‡
Golga5golgin subfamily A member 5NP_001028237KKS*EPDDELLFDFLNSSQKS1161.251.15
Golgb1Golgin subfamily B member 1NP_620240DQHGTLEAGPLNDTGMELNS*PQPDGVDKS6140.640.05*‡
Grlf1PREDICTED: glucocorticoid receptor DNA- binding factor 1XP_001053554KVS*AVSKPVLYRS10460.220.18
Gsk3aglycogen synthase kinase- 3 alphaNP_059040GEPNVS*YICSRS278^- 1.611.94
Gsk3aglycogen synthase kinase- 3 alphaNP_059040GEPNVSY*ICSRY2790.120.44
H3f3bhistone H3.3NP_446437FQS*AAIGALQEASEAYLVGLFEDTNLCAIHAKS87^1.392.99
Hdac2histone deacetylase 2NP_445899MLPHAPGVQMQAIPEDAVHEDS*GDEDGEDPDKRS3943.954.21
Hdgfhepatoma- derived growth factorNP_446159AGDMLEDS*PKRPKS165- 0.270.28
Hdgfhepatoma- derived growth factorNP_446159S*CAEEPEVEPEAHEGDGDKS107n/an/a
Hist1h1dhistone H1.2NP_579819KAS*GPPVSELITKS36- 0.040.02
Hist1h1dhistone H1.2NP_579819RKAS*GPPVSELITKS360.350.75
Hist1h1dhistone H1.2NP_579819S*GPPVSELITKS36^0.260.54
Hist1h2ailhistone H3.1NP_001013074FQSSAVMALQEACEAY*LVGLFEDTNLCAIHAKY1000.982.19
Hist1h4bhistone H4NP_073177RIS*GLIYEETRS48- 0.340.07*
Hmgn1high- mobility group nucleosome binding domain 1NP_001013202QAEVADQQTTDLPAENGETENQSPAS*EEEKS87^n/an/a
Hn1hematological and neurological expressed 1 proteinNP_001005876S*NSSEASSGDFLDLKS80^0.420.25
Hnf1ahepatocyte nuclear factor 1- alphaNP_036801MVS*KLS*QLQTELLAALLES*GLS*KS3^, S6^, S19^, S22^1.571.64
Hnrnpa1heterogeneous nuclear ribonucleoprotein A1NP_058944SES*PKEPEQLRS6n/an/a
Hnrnpa1heterogeneous nuclear ribonucleoprotein A1NP_058944SES*PKEPEQLRKS6n/an/a
Hnrnpa3heterogeneous nuclear ribonucleoprotein A3 isoform aNP_937765SSGS*PYGGGYGSGGGSGGYGSRS359- 0.500.25
Hnrnpa3heterogeneous nuclear ribonucleoprotein A3 isoform aNP_937765SSGSPY*GGGYGSGGGSGGYGSRY361n/an/a
Hnrnpa3heterogeneous nuclear ribonucleoprotein A3 isoform aNP_937765SSGSPYGGGY*GSGGGSGGYGSRY365- 0.721.00
Hnrnpcheterogeneous nuclear ribonucleoprotein CNP_001020804GDDQLELKDDEKEPEEGEDDRDS*ANGEDDSS291n/an/a
Hnrnpkheterogeneous nuclear ribonucleoprotein KNP_476482GS*YGDLGGPIITTQVTIPKS3791.220.81
Hnrnpkheterogeneous nuclear ribonucleoprotein KNP_476482IIPTLEEGLQLPS*PTATSQLPLESDAVECLNYQHYKS116n/an/a
Hnrnpuheterogeneous nuclear ribonucleoprotein UNP_476480AKS*PQPPVEEEDEHFDDTVVCLDTYNCDLHFKS245- 0.340.42
Hnrph1heterogeneous nuclear ribonucleoprotein HNP_543172HTGPNS*PDTANDGFVRS270.510.60
Hnrph1heterogeneous nuclear ribonucleoprotein HNP_543172HTGPNSPDT*ANDGFVRT30- 0.430.29
Hsd11b2corticosteroid 11- beta- dehydrogenase isozyme 2NP_058777ALRPGQPGPVHDTTQDPNPS*PTVSALS3940.460.98
Hsp90aa1heat shock protein HSP 90- alphaNP_786937ESDDKPEIEDVGS*DEEEEEKS263n/an/a
Hsp90aa1heat shock protein HSP 90- alphaNP_786937ESDDKPEIEDVGS*DEEEEEKKS263n/an/a
Hsp90aa1heat shock protein HSP 90- alphaNP_786937ESDDKPEIEDVGS*DEEEEEKKDGDKS263n/an/a
Hsp90ab1heat shock protein HSP 90- betaNP_001004082IEDVGS*DEEDDSGKS255n/an/a
Hsp90ab1heat shock protein HSP 90- betaNP_001004082IEDVGS*DEEDDSGKDKS255n/an/a
Hsp90ab1heat shock protein HSP 90- betaNP_001004082IEDVGS*DEEDDSGKDKKS255n/an/a
Hspa4heat shock 70 kDa protein 4NP_705893MQVDQEEPHTEEQQPQT*PAENKT5380.970.44
Hspa9stress- 70 protein, mitochondrialNP_001094128EAAEKAKCELSSSVQT*DINLPYLTMDASGPKT325^0.000.45
Hspb1heat shock protein beta- 1NP_114176QLS*SGVSEIRS851.371.57
Hspc159galectin- related proteinNP_001128202LDDGHLNNSLGS*PVQADVYFPRS25n/an/a
Htatsf1HIV- 1 Tat specific factor 1NP_001101729VFDDS*DEKEDEEDTDVRS698n/an/a
InadlPREDICTED: InaD- like (Drosophila) isoform 2XP_001055452KTSLSAS*PFEQPSSRS459^0.371.08
Jph1junctophilin- 1NP_001100100SESKSS*IS*S*KRS231^, S233^, S234^n/an/a
Kif26akinesin- like protein KIF26ANP_001163819LLPS*PAPPPPRS9422.420.53*‡
Ktn1PREDICTED: kinectin 1XP_341306EIQNGTLHES*DSEHVPQDFKS751.341.66
Ktn1PREDICTED: kinectin 1XP_341306EIQNGTLHESDS*EHVPQDFKS77^1.351.63
Lad1ladininNP_001101412ALPGKS*PPSSAEQSAPDPPTKS320^- 0.040.30
Lad1ladininNP_001101412GRPEETAAQQKS*PVSEKS181n/an/a
Lad1ladininNP_001101412LPS*VEEAEVSKPSPPAS*KS62, S76^1.100.59
Lad1ladininNP_001101412LPS*VEEAEVSKPSPPAS*KDEGEEFQAILRS62^, S76^0.681.08
Lad1ladininNP_001101412LPS*VEEAEVSKPSPPASKS620.340.21
Lad1ladininNP_001101412LPS*VEEAEVSKPSPPASKDEGEEFQAILRS62n/an/a
Lad1ladininNP_001101412NLS*STTEDESPKS38n/an/a
Lad1ladininNP_001101412S*VEEAEVSKPSPPASKS62- 0.150.24
Lad1ladininNP_001101412S*VEEAEVSKPSPPASKDEGEEFQAILRS62n/an/a
Larp1PREDICTED: la related proteinXP_220446ESPRPPAAAEAPAGS*DGEDGGRS132n/an/a
Larp7la- related protein 7NP_001037755ELVVDSSS*SGVSKATKS166- 0.620.30
Lcp1plastin- 2NP_001012044GS*VSDEEMMELRS5^n/an/a
Lig4ligase IV, DNA, ATP- dependentNP_001099565AAEIVPS*DMYKTGSTLRFPRIEKS567^0.661.24
Lima1PREDICTED: LIM domain and actin binding 1XP_217039FGS*RPEAVTQCRS1322.880.51*‡
Lima1PREDICTED: LIM domain and actin binding 1XP_217039GENEETLGRPAQPPSAGET*PHSPGVEDAPIAKT485n/an/a
Lima1PREDICTED: LIM domain and actin binding 1XP_217039GENEETLGRPAQPPSAGETPHS*PGVEDAPIAKS4880.590.81
Lima1PREDICTED: LIM domain and actin binding 1XP_217039GWSEPEPEQSEEFGGGTVTQT*ESPRPSRT634^n/an/a
Lima1PREDICTED: LIM domain and actin binding 1XP_217039KGWSEPEPEQSEEFGGGTVTQTESPRPS*RS640n/an/a
Lima1PREDICTED: LIM domain and actin binding 1XP_217039PAQPPSAGETPHS*PGVEDAPIAKS4883.783.39
Lima1PREDICTED: LIM domain and actin binding 1XP_217039RLS*ENSCSLDDLEIGAGHLSSSAFNSEKS2250.740.79
Lima1PREDICTED: LIM domain and actin binding 1XP_217039RLSENSCS*LDDLEIGAGHLSSSAFNSEKS230^0.460.50
Lima1PREDICTED: LIM domain and actin binding 1XP_217039S*PLEPESPGWPGFGDTTTAKS6971.130.47
Lima1PREDICTED: LIM domain and actin binding 1XP_217039SEAQQPIYTKPLS*PDARS3600.760.92
Lima1PREDICTED: LIM domain and actin binding 1XP_217039TSSVKS*PKPLSPSLRS603^- 1.421.04
Llgl2lethal(2) giant larvae protein homolog 2NP_001121021SQS*DGAETKPGPVMEHALLSDAWVLKS970^- 0.880.93
Lmnalamin- A isoform C2NP_001002016LRLS*PSPTSQRS389- 0.740.17*‡
Lmo7LIM domain only protein 7NP_001001515EVSRS*PDQFSDMRS1061- 1.131.18
Lmo7LIM domain only protein 7NP_001001515S*KSLSDVSAEDVQSLRS650- 0.860.56
Lmo7LIM domain only protein 7NP_001001515S*LSDVSAEDVQSLRS6521.211.15
Lmo7LIM domain only protein 7NP_001001515SKS*LSDVSAEDVQSLRS652^n/an/a
Lmo7LIM domain only protein 7NP_001001515SLS*DVSAEDVQSLRS6541.201.14
Lmo7LIM domain only protein 7NP_001001515RGES*LDNLDSQRPGSWRS15630.010.12
LOC360570myosin 18aNP_001165608RFS*FSQRS1400.120.41
LOC360570myosin 18aNP_001165608SLAPDLS*DDEHDPVDSISRPRS20200.120.30
LOC360713PREDICTED: pleckstrin homology- like domain, family B, member 2- likeXP_001066275KGS*LQDVDIAGFGSLGHSASFLAPRS5101.220.17*‡
LOC360713PREDICTED: pleckstrin homology- like domain, family B, member 2- likeXP_001066275RLS*AGTTVADVQKS4652.662.56
LOC361100topoisomerase II betaNP_001094328KTSFDQDS*DVDIFPSDFTSEPPALPRS1570n/an/a
LOC361346hypothetical protein LOC361346 precursorNP_001017462SKKY*IGRQDSLDIKY155^0.251.06
LOC366669PREDICTED: similar to Nesprin- 2 (Nuclear envelope spectrin repeat protein 2) (Syne- 2) (Synaptic nuclear envelope protein 2) (Nucleus and actin connecting element protein) (NUANCE protein)XP_001080795LTSHTPGLDDEKEAS*ENETDIEDPRS6383^n/an/a
LOC366669PREDICTED: similar to Nesprin- 2 (Nuclear envelope spectrin repeat protein 2) (Syne- 2) (Synaptic nuclear envelope protein 2) (Nucleus and actin connecting element protein) (NUANCE protein)XP_001080795SISEGHPWHVPDS*PSHSKS6483^0.151.11
LOC366669PREDICTED: similar to Nesprin- 2 (Nuclear envelope spectrin repeat protein 2) (Syne- 2) (Synaptic nuclear envelope protein 2) (Nucleus and actin connecting element protein) (NUANCE protein)XP_001080795TEEGDT*PPIEAALLDFPRT4207n/an/a
LOC680758PREDICTED: rCG41835- likeXP_001058748DGIGHT*PVRERPEET120- 1.691.46
LOC681101PREDICTED: hypothetical proteinXP_001060309WPPGPAAGS*APSGDGRS125- 0.270.19
LOC684097sorting nexin- 3NP_001037748RYS*DFEWLRS723.470.34*‡
LOC684233PREDICTED: spenito- likeXP_001068152SLS*PGGAALGYRS2930.720.68
LOC685179PREDICTED: SWI/SNF- related matrix- associated actin- dependent regulator of chromatin c2 isoform 2XP_001055673DMDEPS*PVPNVEEVTLPKS347n/an/a
LOC688084PREDICTED: similar to COLlagen family member (col- 183)XP_001081078NPS*APGPS55n/an/a
LOC688230PREDICTED: hypothetical proteinXP_001081555LREEEFAKVS*KDLPVDY*DDKS3575, Y35820.911.07
LOC688292PREDICTED: caspase recruitment domain family, member 14- likeXP_001081765EENEKLRSMT*FSLVEKT278^4.470.42*‡
LOC688717SRA stem- loop- interacting RNA- binding protein, mitochondrialNP_001102977VLHGAQTS*DEEKDFS1050.170.58
LOC690284PREDICTED: rCG64368- likeXP_001073960VIS*GPS*DQVRKS441, S444n/an/a
Lpplipoma- preferred partner homologNP_001013886RS*SLDAEIDSLTSILADLECSSPYKPRS116^1.151.47
Lpplipoma- preferred partner homologNP_001013886RSS*LDAEIDSLTSILADLECSSPYKPRS117^0.971.31
Lrbalipopolysaccharide- responsive and beige- like anchor proteinNP_001102025KES*LISPHFTTNSDENSSIGKS8984.450.17*‡
Lrbalipopolysaccharide- responsive and beige- like anchor proteinNP_001102025VEGIEGS*PAEEARS1037- 0.080.98
Lrrc47leucine rich repeat containing 47NP_001129138RES*GEGEEEVADSARS292n/an/a
Lrrfip1leucine- rich repeat flightless- interacting protein 1NP_001014291AENQRPVEDSALS*PGPLAGAKS3020.080.22
Lsm14aprotein LSM14 homolog ANP_001121024RS*PVPARPLPPTSQKS216- 0.880.35
Lsm14aprotein LSM14 homolog ANP_001121024S*SPQLDPLRKS182^0.700.98
Macf1microtubule- actin crosslinking factor 1NP_001129230KLANSEPVGTQT*AKT3419^- 0.320.30
Map2microtubule- associated protein 2NP_037198KVAIIRT*PPKSPAT*PKT1647, T16540.591.68
Map2microtubule- associated protein 2NP_037198VDHGAEIITQS*PSRS1780- 1.990.46
Map3k9PREDICTED: mitogen- activated protein kinase kinase kinase 9XP_576071S*S*PALPGFTSLMEIGKS655^, S656^0.190.49
Map4microtubule- associated protein 4NP_001019449ATS*PSTLVSTGSSSRS7860.140.24
Map4microtubule- associated protein 4NP_001019449RTS*PSKPSSAPALRPGPKS761^n/an/a
Map4microtubule- associated protein 4NP_001019449RTSPS*KPSSAPALRPGPKS763^n/an/a
Map4microtubule- associated protein 4NP_001019449VGS*LDNVGHLPAGGTVKS9781.502.50
Maptmicrotubule- associated protein tauNP_058908KVAVVRT*PPKS*PSASKT164, S168^n/an/a
Maptmicrotubule- associated protein tauNP_058908VAVVRT*PPKSPSAS*KT164, S172^- 1.551.93
MarcksPREDICTED: myristoylated alanine- rich C- kinase substrateXP_002729011EAAEAEPAEPGSPS*AETEGASASSTSSPKS115n/an/a
Matr3matrin- 3NP_062022RDS*FDDRGPSLNPVLDYDHGSRS188- 1.591.05
Mgllmonoglyceride lipaseNP_612511NKS*EVDLYNSDPLICHAGVKS189- 0.090.05
Mllt4afadinNP_037349PENLT*FRERQRT17951.881.84
MmeneprilysinNP_036740GRS*ESQMDITDINAPKPKS41.310.17*‡
MmeneprilysinNP_036740GRSES*QMDITDINAPKPKS6^1.710.35
Mmrn1PREDICTED: rCG55340- likeXP_001065496YVSVLQET*ASKQGLMLLQMLSDLHVQESKT522^1.520.73
Mrpl4739S ribosomal protein L47, mitochondrialNP_001032260KSS*T*VS250^, T251^- 0.571.84
Myh9myosin- 9NP_037326KGTGDCS*DEEVDGKADGADAKS1944n/an/a
Myl9myosin regulatory light polypeptide 9NP_001094355ATS*NVFAMFDQSQIQEFKS20n/an/a
Myl9myosin regulatory light polypeptide 9NP_001094355AT*SNVFAMFDQSQIQEFKT19^n/an/a
Nap1l4nucleosome assembly protein 1- like 4NP_001012170EFITGDVEPTDAESAWHS*ENEEDDKLAGDMKS1250.230.28
Ncbp1nuclear cap- binding protein subunit 1NP_001014785KTS*DANETEDHLESLICKS22n/an/a
Nck1cytoplasmic protein NCK1NP_001100321RKPS*VPDTASPADDSFVDPGERS851.110.85
Ndrg1protein NDRG1NP_001011991T*ASGSSVTSLEGTRT3280.801.08
Ndrg1protein NDRG1NP_001011991TAS*GSSVTSLEGTRS330- 0.160.13
Ndrg2protein NDRG2NP_598267T*ASLTSAASIDGSRT316^1.520.30*‡
Ndrg3protein NDRG3NP_001013945SVTSNQSDGTQESCES*PDVLDRS361n/an/a
Nfibnuclear factor 1 B- typeNP_113754KPEKPLFSSTS*PQDSSPRS328^- 0.300.23
Nid2nidogen- 2NP_001012005SFSLIS*GS*INQTRSYRS705, S7076.246.81
NkaplNKAP- like proteinNP_001025084IGELGAPEVWGLS*PKS139- 0.190.24
Nop56nucleolar protein 56NP_001020903EELAS*DLEEMATSSISVPKS517n/an/a
Nop56nucleolar protein 56NP_001020903KFS*EEPEAAASCTKS5610.480.11
Nop58nucleolar protein 58NP_068522HIKEEPLS*EEEPCTSTAVPSPEKS507n/an/a
Nop58nucleolar protein 58NP_068522HIKEEPLS*EEEPCTSTAVPSPEKKS507- 1.080.38
Npatprotein NPATNP_001101617HTT*VKEVQSEKKT1130^n/an/a
Npm1nucleophosminNP_037124CGSGPVHISGQHLVAVEEDAES*EDEDEEDVKS125n/an/a
Nsd1histone- lysine N- methyltransferase, H3 lysine- 36 and H4 lysine- 20 specificNP_001100807SLS*EDVSDSGTSKS564^n/an/a
Nsfl1cNSFL1 cofactor p47NP_114187KKS*PNELVDDLFKS114n/an/a
Nsfl1cNSFL1 cofactor p47NP_114187RHS*GQDVHVVLKS1760.760.98
Nucb1nucleobindin- 1 precursorNP_445915SGKLS*QELDFVSHNVRS85- 0.260.18
Nucks1nuclear ubiquitous casein and cyclin- dependent kinases substrateNP_073636KVVDYSQFQES*DDADEDYGRS19n/an/a
Nucks1nuclear ubiquitous casein and cyclin- dependent kinases substrateNP_073636VVDYSQFQES*DDADEDYGRS19n/an/a
Numa1PREDICTED: nuclear mitotic apparatus protein 1XP_218972AAQLQGS*PAPEKGEVLGDALQLDTLKS4161.070.66
Numa1PREDICTED: nuclear mitotic apparatus protein 1XP_218972TQPDGTSVPGEPAS*PISQRS1769- 0.130.41
Numa1PREDICTED: nuclear mitotic apparatus protein 1XP_218972VPSTYPSTLSEELS*PPSHQAKS185- 0.140.36
Nup98nuclear pore complex protein Nup98NP_112336NLNNSNLFSPVNHDSEDLAS*PSEYPENGERS623^n/an/a
Olr1061olfactory receptor Olr1061NP_001000065MSNS*GLRS4n/an/a
Osbpoxysterol- binding protein 1NP_001102397GDMS*DEDDENEFFDAPEIITMPENLGHKS2261.081.39
PalmparalemminNP_570842LNGS*AAELPATKS3450.660.90
PalmparalemminNP_570842SETMVNAQQTPLGT*PKT145- 1.090.17*‡
PalmdpalmdelphinNP_001020859SNGLAHTS*PTRPTPQPRS322^n/an/a
Pard3partitioning defective 3 homologNP_112514RSS*DPALTGLSTSVSDNNFSSEEPSRS144n/an/a
Pcloprotein piccolo isoform 2NP_001104267KLAVAAT*VT*STTIVTTHVDALTMVEAAAART2394^, T2396^0.291.15
Pdha1pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial precursorNP_001004072Y*HGHSMSDPGVS*YRY289, S300n/an/a
Pdha1pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial precursorNP_001004072YGMGT*SVERT2310.800.76
Pdha1pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial precursorNP_001004072YGMGTS*VERS232- 0.140.07
Pdha1pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial precursorNP_001004072YHGHS*MSDPGVS*YRS293, S300- 0.250.08
Pdha1pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial precursorNP_001004072YHGHS*MSDPGVSY*RS293, Y3010.510.79
Pdha1pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial precursorNP_001004072YHGHS*MSDPGVSYRS293- 0.971.07
Pdha1pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial precursorNP_001004072YHGHSMS*DPGVS*YRS295^, S300^- 1.450.88
Pdha1pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial precursorNP_001004072YHGHSMS*DPGVSY*RS295^, Y301^n/an/a
Pdha1pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial precursorNP_001004072YHGHSMS*DPGVSYRS295- 0.070.15
Pdha1pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial precursorNP_001004072YHGHSMSDPGVS*YRS300^- 0.110.18
Pds5bsister chromatid cohesion protein PDS5 homolog B isoform 1NP_001095853AESPETS*AVESTQSTPQKS1364^n/an/a
Pdxdc1pyridoxal- dependent decarboxylase domain- containing protein 1NP_001128433VQGTGVT*PPPTPSGTRT6870.800.06
Pebp1phosphatidylethanolamine- binding protein 1NP_058932VLTPTQVMNRPS*SISWDGLDPGKS510.150.28
Pebp1phosphatidylethanolamine- binding protein 1NP_058932VLTPTQVMNRPSS*ISWDGLDPGKS520.140.28
Pebp1phosphatidylethanolamine- binding protein 1NP_058932FKVES*FRS153- 0.500.12*
Pex19peroxisomal biogenesis factor 19 isoform 2NP_001128249AKPS*PAPS*PTISAPDASGPQKS35, S39^n/an/a
Pex19peroxisomal biogenesis factor 19 isoform 2NP_001128249AKPS*PAPSPT*ISAPDASGPQKS35, T41n/an/a
Pgm1phosphoglucomutase- 1NP_058729AIGGIILTAS*HNPGGPNGDFGIKS1170.280.13
Pgrmc2membrane- associated progesterone receptor component 2NP_001008375LLKPGEEPSEY*TDEEDTKY2041.210.79
Pgrmc2membrane- associated progesterone receptor component 2NP_001008375LLKPGEEPSEY*TDEEDTKDHSKQDY204^- 4.792.49
Pgrmc2membrane- associated progesterone receptor component 2NP_001008375LLKPGEEPSEYT*DEEDTKT2052.481.16
Pgrmc2membrane- associated progesterone receptor component 2NP_001008375LLKPGEEPSEYT*DEEDTKDHSKT2050.240.57
Pgrmc2membrane- associated progesterone receptor component 2NP_001008375LLKPGEEPSEYT*DEEDTKDHSKQDT205- 4.822.48
Phactr1phosphatase and actin regulator 1NP_999622RLS*QRPTAEELEQRS4672.162.53
Phlpp1PH domain leucine- rich repeat protein phosphatase 1NP_067689GKMQLPVNRWT*RRT521n/an/a
Pi4kbphosphatidylinositol 4- kinase betaNP_112345S*VENLPECGITHEQRS428^n/an/a
Pkn2serine/threonine- protein kinase N2NP_001099225AS*SLGEIDDSSELRS581^n/an/a
Pkp2plakophilin- 2NP_001093969TSS*VPEYVYKS820.912.12
Plecplectin isoform 1cNP_001157768SSS*VGSSSSYPISSAVPRS42750.820.23
Plekha6PREDICTED: pleckstrin homology domain containing, family A member 6XP_341119YIDLEPVAPLS*PEELKS1167n/an/a
Plekha6PREDICTED: pleckstrin homology domain containing, family A member 6XP_341119HRS*IHEVDISNLEAALRS10940.451.03
Plekha6PREDICTED: pleckstrin homology domain containing, family A member 6XP_341119S*IHEVDISNLEAALRS10941.450.17*‡
Plekha6PREDICTED: pleckstrin homology domain containing, family A member 6XP_341119T*KSPAEEEITPSAVVRT10011.802.16
Plekha6PREDICTED: pleckstrin homology domain containing, family A member 6XP_341119TKS*PAEEEITPSAVVRS10030.250.60
Plekhg3PREDICTED: pleckstrin homology domain containing, family G (with RhoGef domain) member 3 isoform 2XP_234320RRES*LSYIPKS10643.343.05
Plxdc2plexin domain- containing protein 2NP_001101892RGS*GHPAYAEVEPVGEKS5071.690.32*‡
PnnpininNP_001102493QES*DPEDDDVKKPALQSSVVATSKS100^n/an/a
PnnpininNP_001102493S*LSPGKENINSLEVEKS440^- 2.581.26
PnnpininNP_001102493SLS*PGKENINSLEVEKS442- 2.581.26
Ppfibp1liprin- beta- 1NP_001101366RRPS*DENSITPSEVQQWTNHRS7130.360.23
Ppm1gprotein phosphatase 1GNP_671742KLEEALST*EGAEENGNSDKT525^n/an/a
Ppp1r1aprotein phosphatase 1 regulatory subunit 1ANP_073167RPT*PATLVLTSDQSSPEVDEDRIPNPLLKT351.530.20*‡
Ppp1r1aprotein phosphatase 1 regulatory subunit 1ANP_073167RPTPATLVLT*SDQSSPEVDEDRT42^n/an/a
Ppp1r1aprotein phosphatase 1 regulatory subunit 1ANP_073167RRPT*PATLVLTSDQSSPEVDEDRT35n/an/a
Ppp1r1aprotein phosphatase 1 regulatory subunit 1ANP_073167RRPTPATLVLTSDQSS*PEVDEDRIPNPLLKS47^- 0.160.14
Ppp1r1aprotein phosphatase 1 regulatory subunit 1ANP_073167STLSMS*PRS67n/an/a
Ppp1r1bprotein phosphatase 1 regulatory subunit 1BNP_612530IAESHLQTISNLSENQAS*EEEDELGELRS1020.200.08
Ppp1r1bprotein phosphatase 1 regulatory subunit 1BNP_612530RRPT*PALLFRT346.200.49*‡
Ppp1r2protein phosphatase inhibitor 2NP_620178IDEPDTPYHNMIGDDEDVCS*DSEGNEVMTPEILAKS87^n/an/a
Ppp2r5dPREDICTED: delta isoform of regulatory subunit B56, protein phosphatase 2AXP_001062510RKS*ELPQDVYTIKS6322.110.46*‡
Pqcpenhanced at puberty protein 1NP_001012488KAS*PEPPDSAESALKS534- 1.061.22
Prkab15'- AMP- activated protein kinase subunit beta- 1NP_114182CSDVSELSSS*PPGPYHQEPYISKPEERS182^- 0.200.44
PrkacbcAMP- dependent protein kinase catalytic subunit betaNP_001071113T*WTLCGTPEYLAPEIILSKT196^0.871.71
PrkacbcAMP- dependent protein kinase catalytic subunit betaNP_001071113TWT*LCGTPEYLAPEIILSKT198^0.841.76
Prkar1acAMP- dependent protein kinase type I- alpha regulatory subunitNP_037313EDEIS*PPPPNPVVKS832.231.49
Prkar1acAMP- dependent protein kinase type I- alpha regulatory subunitNP_037313TDSREDEIS*PPPPNPVVKS830.611.86
Prkar2acAMP- dependent protein kinase type II- alpha regulatory subunitNP_062137RVS*VCAETFNPDEEEDNDPRS970.380.63
Prkar2bcAMP- dependent protein kinase type II- beta regulatory subunitNP_001025191RAS*VCAEAYNPDEEEDDAESRS112n/an/a
Prkcdprotein kinase C delta typeNP_579841SPSDYSNFDPEFLNEKPQLS*FSDKS6430.260.11
Prkcdprotein kinase C delta typeNP_579841SPSDYSNFDPEFLNEKPQLSFS*DKS645^n/an/a
Prkcdbpprotein kinase C delta- binding proteinNP_604444KGS*EAAQPTPVKPPRS199^- 0.080.27
Prpsap1phosphoribosyl pyrophosphate synthase- associated protein 1NP_071990LGLAVIHGEAQCTELDMDDGRHS*PPMVKS244n/an/a
Psapsulfated glycoprotein 1 isoform A preproproteinNP_037145NGGFCEVCKKLVIY*LEHNLEKNSTKY448- 0.100.47
Ptpn18tyrosine- protein phosphatase non- receptor type 18NP_001013129IQRPVS*HTENAQGTTALGRS393n/an/a
Ptpn21tyrosine- protein phosphatase non- receptor type 21NP_598229RNS*IEIAGLTHGFEGLRS6370.280.53
Ptrfpolymerase I and transcript release factorNP_001099311ATEEPSGTGS*DELIKS421.441.27
Pum1pumilio homolog 1NP_001102154RDS*LTGSSDLYKS7101.520.13*‡
PxnpaxillinNP_001012147TGS*SSPPGGLSKPGSQLDSMLGSLQSDLNKS3151.000.19*‡
PxnpaxillinNP_001012147TGSSS*PPGGLSKPGSQLDSMLGSLQSDLNKS317^0.970.13
PxnpaxillinNP_001012147YAHQQPPS*PSPIYSSSTKS83- 0.090.20
Qdprdihydropteridine reductaseNP_071785SLFKNCDLMWKQSIWTS*TISSHLATKHLKS112^n/an/a
Rai1PREDICTED: retinoic acid induced 1XP_220520SCT*APSAQPHDRPMSANASLAPGQRT232n/an/a
RalyRNA- binding protein RalyNP_001011958GRLS*PVPVPRS119- 0.900.57
Ranbp2PREDICTED: RAN binding protein 2 isoform 2XP_215401QNQPTSAVSAPASS*ETSKSPKS1638^n/an/a
Ranbp2PREDICTED: RAN binding protein 2 isoform 2XP_215401QNQPTSAVSAPASSETS*KSPKS1641^n/an/a
Ranbp2PREDICTED: RAN binding protein 2 isoform 2XP_215401QNQPTSAVSAPASSETSKS*PKS16430.582.15
Rap1gapPREDICTED: Rap1 GTPase- activating proteinXP_233609RGS*ALGIGAVEESLIVPGKS*PTRS557, S5744.980.66*‡
Rap1gapPREDICTED: Rap1 GTPase- activating proteinXP_233609RSS*AIGIENIQEVQEKS5892.400.30*‡
Rap1gapPREDICTED: Rap1 GTPase- activating proteinXP_233609SQS*MDAMGLSNKS5055.360.67*‡
Raver1ribonucleoprotein PTB- binding 1NP_001013961HKMS*PPPSSFSEPRS626- 0.230.11
Rbm14PREDICTED: RNA binding motif protein 14XP_001072105RLS*ESQLSFRS6182.100.24*‡
Rbm14PREDICTED: RNA binding motif protein 14XP_001072105T*PPFFGRT206- 0.320.16
Rbm39RNA- binding protein 39NP_001013225DKS*PVREPIDNLTPEERS136- 0.050.17
Rbm39RNA- binding protein 39NP_001013225KDKS*PVREPIDNLTPEERS1360.670.87
RGD1304931hypothetical protein LOC313776NP_001101471YS*GSPDSAAIQMSSPQLTEARPKS196^2.051.80
RGD1305269PREDICTED: LIM and calponin homology domains 1 isoform 4XP_223397SINHQIES*PGERS1118n/an/a
RGD1306410hypothetical protein LOC360768NP_001014148HIEPELAGRDS*PVRS2641.952.20
RGD1308601hypothetical protein LOC307249NP_001100844RDS*SESQLASTESDKPTTGRS66- 0.090.56
RGD1308601hypothetical protein LOC307249NP_001100844RDSS*ESQLASTESDKPTTGRS67n/an/a
RGD1308601hypothetical protein LOC307249NP_001100844RDSSES*QLASTESDKPTTGRS69^n/an/a
RGD1309108PREDICTED: hypothetical proteinXP_236102T*IPKPKPPNLPY*QT*MKT715, Y726, T728n/an/a
RGD1309922hypothetical protein LOC306007NP_001163943VSKDEVQNEGTAAEADS*PLKEDGLLPKS612- 0.700.41
RGD1310230mitochondrial fission factorNP_001034104VLTLSERPLDFLDLERPPPT*PQSEEIRT112^n/an/a
RGD1311728PREDICTED: RIKEN cDNA 9130221D24- likeXP_227688RKT*DTVVDSSVSGDHSGSLRT23- 1.471.36
RGD1560083PREDICTED: myosin IIIAXP_574090QLVNHPLTKT*GNLPLS*KT1124^, S1130^n/an/a
RGD1560286similar to DNA segment, Chr 4, ERATO Doi 22, expressed isoform 1NP_001108071ILGSAS*PEEEQEKPILDRPTRS107- 0.100.21
RGD1561118PREDICTED: transcription elongation factor B (SIII), polypeptide 2XP_220759KTTIFAEAQESS*T*VLELKS22, T23n/an/a
RGD1561149hypothetical protein LOC500552NP_001128101GS*PSGGSTAEVSDTASIRS403n/an/a
RGD1561149hypothetical protein LOC500552NP_001128101LQLERPVS*PEAQADLQRS914- 0.460.10*
RGD1561445PREDICTED: hypothetical proteinXP_233277SST*T*FNLEEKT1543, T1544n/an/a
RGD1561963_predictedPREDICTED: similar to Dedicator of cytokinesis protein 10 (Protein zizimin 3)XP_001060744S*Y*KERT*IHEELAKS1158, Y1159, T1163n/an/a
RGD1562952_predictedPREDICTED: similar to Erbb2 interacting protein isoform 1XP_001072232TSEPEAETNAGNS*PVTTNRS580^n/an/a
RGD1563245PREDICTED: G protein- coupled receptor 161XP_222837EAAKNS*ILHVKS495n/an/a
RGD1563437PREDICTED: enhancer trap locus 4- likeXP_001069190HQEETTHAPGQPLHCS*TGSPGDVKS918^0.430.63
RGD1563437PREDICTED: enhancer trap locus 4- likeXP_001069190HQEETTHAPGQPLHCSTGS*PGDVKS921^- 0.220.11
RGD1563437PREDICTED: enhancer trap locus 4, partialXP_214519LGGKS*PPPPPPPPRS920.030.27
RGD1564174PREDICTED: tensin 3XP_341257WDS*YENMSADGEVLHTQGPVDGSLYAKS409^n/an/a
RGD1564748PREDICTED: mortality factor 4 like 2- likeXP_228426RS*NPS*EEGHS*VKS336, S339, S344n/an/a
RGD1565496hypothetical protein LOC300783NP_001100301WLDES*DAEMELRS1140.220.40
Rims1regulating synaptic membrane exocytosis protein 1NP_439894S*LTQKPGS*KS1423, S1430n/an/a
RnmtmRNA cap guanine- N7 methyltransferaseNP_001008300GGGSEDEPS*PGGLTERS99n/an/a
Rpl3560S ribosomal protein L35NP_997676QLDDLKVELS*QLRS290.150.38
Rps340S ribosomal protein S3NP_001009239DEILPT*TPISEQKT220^2.532.35
Rps340S ribosomal protein S3NP_001009239DEILPTT*PISEQKT2212.532.35
Rras2ras- related protein R- Ras2NP_001013452FQEQECPPS*PEPTRS1860.220.37
Rras2ras- related protein R- Ras2NP_001013452FQEQECPPS*PEPTRKS186- 0.960.73
Rras2ras- related protein R- Ras2NP_001013452KFQEQECPPS*PEPTRS186- 0.960.75
Rras2ras- related protein R- Ras2NP_001013452KFQEQECPPS*PEPTRKS186- 0.180.20
Rtn4reticulon- 4NP_114019GPLPAAPPAAPERQPS*WERS107- 1.050.71
Rtn4reticulon- 4NP_114019LPAAPPAAPERQPS*WERS1070.620.65
Rtn4reticulon- 4NP_114019RRGS*GSVDETLFALPAASEPVIPSSAEKS169^- 1.330.43
Rtn4reticulon- 4NP_114019RRGSGS*VDETLFALPAASEPVIPSSAEKS171^1.260.97
Rtn4reticulon- 4NP_114019SKDKEDLVCSAALHS*PQESPVGKS3294.812.54
Sccpdhprobable saccharopine dehydrogenaseNP_001014007SVS*NLKPVPVIGSKS217- 0.420.50
Scfd1sec1 family domain- containing protein 1NP_062237VNLEESTGVENS*PTGARPKS298^4.064.14
ScribPREDICTED: scribbled homolog isoform 5XP_343267MQS*PELPAPERS1483n/an/a
ScribPREDICTED: scribbled homolog isoform 5XP_343267MVEPENAVTITPLRPEDDY*SPRY818- 0.410.09*
Sec22bvesicle- trafficking protein SEC22bNP_001020857NLGS*INTELQDVQRS1374.740.77*‡
Sec23ipSEC23- interacting proteinNP_001128331KLS*VGAYVSSVRS749- 0.490.09*
Sec61bprotein transport protein Sec61 subunit betaNP_001100124PGPTPSATNVGSSGRS*PSKS17- 1.090.25*‡
Sec62translocation protein SEC62NP_001029301EELEQQT*DGDCDEEDDDKDGEMPKT582n/an/a
Sept2septin- 2NP_476489IYHLPDAES*DEDEDFKEQTRS218- 0.170.20
Sept4septin 4NP_001011893IYQFPDCDS*DEDEDFKLQDQALKS206n/an/a
Sfrs3splicing factor, arginine/serine- rich 3NP_001041372SLS*RDRRS130^n/an/a
Sfrs6splicing factor, arginine/serine- rich 6NP_001014207SHS*PLPAPPSKS303- 1.080.86
Sgtasmall glutamine- rich tetratricopeptide repeat- containing protein alphaNP_073194GPDRT*PPSEEDSAEAERT81n/an/a
Sh3gl2PREDICTED: endophilin- A1XP_342858S*GVQMDQPCCRS400n/an/a
Shank2SH3 and multiple ankyrin repeat domains protein 2 isoform cNP_597684RAPS*PVVS*PTELSKS1119, S1123- 0.210.60
Shank2SH3 and multiple ankyrin repeat domains protein 2 isoform dNP_597685SNS*DNNLNAGAPEWAVCSAATSHRS43^n/an/a
Slc12a1solute carrier family 12 member 1NP_062007KDS*NISTIQSMHVGEFNQKS8743.050.71*‡
Slc12a1solute carrier family 12 member 1NP_062007TDTTFHAYDSHT*NTYYLQTFGHNTMDAVPKT89^1.310.23*‡
Slc12a1solute carrier family 12 member 1NP_062007VNRPS*LQEIHEQLAKS1265.900.24*‡
Slc16a7monocarboxylate transporter 2NP_058998VSNTHNPPSDRDKESS*IS488n/an/a
Slc25a46solute carrier family 25 member 46NP_001093985SFGSGTELGHWVTT*PPDIPGSRT450.160.13
Slc2a4solute carrier family 2, facilitated glucose transporter member 4NP_036883RTPS*LLEQEVKPSTELEYLGPDENDS488^0.970.22*‡
Slc43a2large neutral amino acids transporter small subunit 4NP_001099282LCLS*TVDLEVKS297- 1.500.16*‡
Slc43a2large neutral amino acids transporter small subunit 4NP_001099282LCLST*VDLEVKT298^n/an/a
Slc43a2large neutral amino acids transporter small subunit 4NP_001099282REDS*KLFLKS5523.053.00
Slc43a2large neutral amino acids transporter small subunit 4NP_001099282RLS*VGSSMRS2740.880.18*‡
Slc4a2anion exchange protein 2NP_058744RRPGAS*PTGETPTIEEGEEDEDEVGEAEGFRS1130.210.06
Slc4a2anion exchange protein 2NP_058744RRPGASPT*GETPTIEEGEEDEDEVGEAEGFRT1150.240.08
Slc4a2anion exchange protein 2NP_058744TS*PSPPTQTPHQEAAPRS171^0.080.17
Slc5a3solute carrier family 5 (inositol transporters), member 3NP_446167EEGNPVASMGHSEAET*PVDAYSNGQAALMGERT626n/an/a
Slc9a1sodium/hydrogen exchanger 1NP_036784IGS*DPLAYEPKS7071.471.66
Slc9a1sodium/hydrogen exchanger 1NP_036784SKEPSSPGTDDVFTPGPSDS*PGSQRS790^n/an/a
Slc9a3sodium/hydrogen exchanger 3NP_036786RGS*LAFIRS5522.070.30*‡
Slc9a3sodium/hydrogen exchanger 3NP_036786VQIPNS*PSNFRS791- 0.730.32
Slc9a3r1Na(+)/H(+) exchange regulatory cofactor NHE- RF1NP_067605EALVEPASES*PRPALARS277^- 0.060.22
Slc9a3r1Na(+)/H(+) exchange regulatory cofactor NHE- RF1NP_067605SAS*SDTSEELNAQDSPKS287n/an/a
Slc9a3r1Na(+)/H(+) exchange regulatory cofactor NHE- RF1NP_067605SASS*DTSEELNAQDSPKS288^n/an/a
Slc9a3r1Na(+)/H(+) exchange regulatory cofactor NHE- RF1NP_067605SASSDT*SEELNAQDSPKT290- 0.200.40
SlkSTE20- like serine/threonine- protein kinaseNP_062222RDS*FIGTPYWMAPEVVMCETSKS189- 0.910.78
Smarca2probable global transcription activator SNF2L2NP_001004446GRPPAEKLS*PNPPKS1384- 1.130.43
Smpxsmall muscular proteinNP_445847RKES*TPGTAEGAPAT*PEEKS36, T47n/an/a
Smpxsmall muscular proteinNP_445847RKES*TPGTAEGAPATPEEKS364.470.42*‡
Smpxsmall muscular proteinNP_445847RKESTPGT*AEGAPATPEEKT404.650.74*‡
Snap23synaptosomal- associated protein 23NP_073180ATWGDGGDSS*PSNVVSKS1100.080.26
Sntb1beta- 1- syntrophinNP_001124014GSGTGHPGTGVPQAPDS*PAGVRS88- 0.340.19
Sntb2syntrophin, beta 2NP_001162145GLGPPS*PPAPPRS771.661.74
Sntb2syntrophin, beta 2NP_001162145KPS*LVSDLPWEGASPQSPSFSGSEDS*GSPKS190^, S213 ^n/an/a
Sntb2syntrophin, beta 2NP_001162145KPSLVSDLPWEGAS*PQSPSFSGSEDSGSPKS201^0.450.45
Sntb2syntrophin, beta 2NP_001162145KPSLVSDLPWEGASPQS*PSFSGSEDSGS*PKS204^, S215^n/an/a
Sntb2syntrophin, beta 2NP_001162145KPSLVSDLPWEGASPQS*PSFSGSEDSGSPKS2040.080.11
Sntb2syntrophin, beta 2NP_001162145KPSLVSDLPWEGASPQSPSFS*GSEDSGSPKS208^0.080.11
Sntb2syntrophin, beta 2NP_001162145KPSLVSDLPWEGASPQSPSFSGSEDSGS*PKS215^0.210.09
Sort1sortilin precursorNP_113955YS*VLQQHAEADGVEALDTASHAKS7913.870.46*‡
Sphk2sphingosine kinase 2NP_001012066AKS*ELALAPAPAPAAT*HSPLHRS364, T377^n/an/a
Sphk2sphingosine kinase 2NP_001012066AKS*ELALAPAPAPAATHS*PLHRS364, S379^n/an/a
Spint2serine protease inhibitor, Kunitz type 2 isoform bNP_954518NSCS*SFIYGGCRS100n/an/a
Spna2spectrin alpha chain, brainNP_741984WRS*LQQLAEERS1217- 0.600.26
Spp1osteopontin precursorNP_037013ISHELESSS*SEVNS3130.660.80
Sptbn1spectrin beta chain, brain 1NP_001013148GDQVS*QNGLPAEQGSPRS21220.930.83
Sptbn1spectrin beta chain, brain 1NP_001013148GDQVSQNGLPAEQGS*PRS21320.060.33
Sptbn1spectrin beta chain, brain 1NP_001013148VSEEAESQQWDTSKGDQVS*QNGLPAEQGSPRS2122n/an/a
Sptbn1spectrin beta chain, brain 1NP_001013148VSEEAESQQWDTSKGDQVSQNGLPAEQGS*PRS2132n/an/a
Srrm1serine/arginine repetitive matrix protein 1NP_001101456RRS*PS*PAPPPPPPPPPRS558, S560n/an/a
Srrm1serine/arginine repetitive matrix protein 1NP_001101456RYS*PPIQRS601^0.080.18
Srrm2PREDICTED: serine/arginine repetitive matrix 2XP_220207DKFS*PTQDRPESSTVLKS11531.221.39
Srrm2PREDICTED: serine/arginine repetitive matrix 2XP_220207ELSHS*PPRDNSFESLEFRS1280^- 0.280.41
Srrm2PREDICTED: serine/arginine repetitive matrix 2XP_220207S*PVPSAFSDQSRS2407n/an/a
Srrm2PREDICTED: serine/arginine repetitive matrix 2XP_220207SSS*PVTELTARS10701.851.67
Ssr1translocon- associated protein subunit alphaNP_001008891VEMGTSSQNDVDMSWIPQET*LNQINKASPRT261^n/an/a
Ssrp1FACT complex subunit SSRP1NP_112383EGINPGYDDYADS*DEDQHDAYLERS444n/an/a
St14matriptaseNP_446087GGGS*QDFGAGLKS133.730.86*‡
Stat1signal transducer and activator of transcription 1 isoform alphaNP_116001LQSTENLLPMS*PEEFDEMSKS7271.602.41
Stat3signal transducer and activator of transcription 3NP_036879YCRPESQEHPEADPGSAAPY*LKY705- 0.110.09
Stk40serine/threonine- protein kinase 40NP_898879LSERETVVIFY*DVVRY179^n/an/a
Stx4syntaxin- 4NP_112387QGDNIS*DDEDEVRS15n/an/a
Stxbp5syntaxin- binding protein 5 isoform mNP_110470DPYRREPRS*PRS685^n/an/a
Suv420h1histone- lysine N- methyltransferase SUV420H1NP_001101982DSIDIDISS*RRRS871^n/an/a
Tacc2transforming acidic coiled coil 2 isoform 1NP_001004415LDNTPAS*PPRS*PAEPSDIPIAKS2207, S2211n/an/a
Tceb3transcription elongation factor B polypeptide 3NP_058799S*PEMDQEPIVSHPKPGKS1950.070.19
Tcfap2dtranscription factor AP- 2- deltaNP_001100365QHMEQKEQT*ARKKT166n/an/a
Tgfb1i1PREDICTED: transforming growth factor beta- 1- induced transcript 1 proteinXP_341935VQNHLPASGPPQPPAVS*PTRS186^n/an/a
Tgfb1i1PREDICTED: transforming growth factor beta- 1- induced transcript 1 proteinXP_341935VQNHLPASGPPQPPAVSPT*RT188n/an/a
Tgoln1trans- Golgi network integral membrane protein TGN38 precursorNP_620195VLGPSS*SENQEGTLTDSMKDEKS271^0.760.98
Thoc2PREDICTED: THO complex 2XP_233081GGEKPPVSGSLKS*PVPRS13930.540.44
Thrap3thyroid hormone receptor- associated protein 3NP_001009693ERS*PALKS*PLQSVVVRS248, S2530.250.59
Thrap3thyroid hormone receptor- associated protein 3NP_001009693IDIS*PSTFRS679- 0.030.07
Tjp1tight junction protein ZO- 1NP_001099736AVPVS*PSAVEEDEDEDGHTVVATARS1602- 0.080.13
Tjp1tight junction protein ZO- 1NP_001099736FNHNLLPSETVHKPELS*SKPPPSPKS1549^0.631.24
Tjp1tight junction protein ZO- 1NP_001099736FNHNLLPSETVHKPELSSKPPPS*PKS15551.381.90
Tjp1tight junction protein ZO- 1NP_001099736MSKPGAVS*TPVKHVDDHTPKS341^- 0.580.54
Tjp1tight junction protein ZO- 1NP_001099736S*REDLSAQPVQTKS605n/an/a
Tjp1tight junction protein ZO- 1NP_001099736SREDLS*AQPVQTKS610- 0.080.10
Tjp2tight junction protein ZO- 2NP_446225KVQVAPLQGS*PPLSHDDRS107- 0.620.13*‡
Tjp3tight junction protein ZO- 3NP_001101543AIAEPES*PGESRS348n/an/a
Tmem139PREDICTED: transmembrane protein 139- likeXP_002726399VVST*APDLQSLRT1710.321.11
Tmem143transmembrane protein 143NP_001100983VWSLVPALLGT*PRALSS*LENRMGAY*RT37^, S43^, Y51^- 1.183.35
Tmpolamina- associated polypeptide 2, isoform betaNP_037019QNGSNDSDRYS*DNDEDSKIELKS183^n/an/a
Tmpolamina- associated polypeptide 2, isoform betaNP_037019SST*PLPTVSSSAENTRT1590.260.14
Tmx1thioredoxin- related transmembrane protein 1NP_001019971KVEEEQEADEEDVS*EEETENRS245n/an/a
Tmx1thioredoxin- related transmembrane protein 1NP_001019971VEEEQEADEEDVS*EEETENRS245n/an/a
Tnks1bp1PREDICTED: tankyrase 1 binding protein 1XP_215763RAS*VSTNQNTDENDQELRS883n/an/a
Tnks1bp1PREDICTED: tankyrase 1 binding protein 1XP_215763RFS*EGVLRPPSQDQEKS4230.540.65
Tnks1bp1PREDICTED: tankyrase 1 binding protein 1XP_215763S*SGSLSPGLETEDPLEARS1355^n/an/a
Tnks1bp1PREDICTED: tankyrase 1 binding protein 1XP_215763SSGSLS*PGLETEDPLEARS1360n/an/a
Tns1PREDICTED: tensin 1XP_237286AINPTMAAPGSPSLS*HRS1467- 2.040.06*‡
Tns1PREDICTED: tensin 1XP_237286ET*TSDTSRTPEEEPLNLEGLVAHRT11080.040.04
Tns1PREDICTED: tensin 1XP_237286ETTSDTSRT*PEEEPLNLEGLVAHRT11150.010.07
Tns1PREDICTED: tensin 1XP_237286HLGGSGSVVPGS*PSLDRS1568- 0.860.15*‡
Tns1PREDICTED: tensin 1XP_237286HLGGSGSVVPGSPS*LDRS1570^- 1.150.12
Tns1PREDICTED: tensin 1XP_237286HPVGSHQVPGLHSGVVTTPGS*PSLGRS1523- 2.020.28*‡
Tns1PREDICTED: tensin 1XP_237286HVAYGGYST*PEDRT1582- 0.980.12*‡
Tns1PREDICTED: tensin 1XP_237286KKDS*LNGSSGPITTARS6281.180.25*‡
Tns1PREDICTED: tensin 1XP_237286MAAPGS*PSLSHRS1463^n/an/a
Tns1PREDICTED: tensin 1XP_237286QVMGPSGPGFHGNVVSGHPTSATVAPGS*PSLGRS1497^- 2.340.28*‡
Tns1PREDICTED: tensin 1XP_237286S*QSFPDVEPQLPQAPARS873^0.260.17
Tns1PREDICTED: tensin 1XP_237286SQS*FPDVEPQLPQAPARS8750.700.59
Tns1PREDICTED: tensin 1XP_237286SYS*PYDYQLHPAASNQSFRPKS1052n/an/a
Tns1PREDICTED: tensin 1XP_237286T*PEEEPLNLEGLVAHRT1115n/an/a
Tns1PREDICTED: tensin 1XP_237286TVGTNTPPS*PGFGRS1446- 0.680.16*‡
Tns1PREDICTED: tensin 1XP_237286VGSHQVPGLHSGVVTTPGS*PSLGRS1523- 2.890.60*‡
Tns1PREDICTED: tensin 1XP_237286WDS*YDNFNGHRS5921.881.49
Tomm34mitochondrial import receptor subunit TOM34NP_001037709NRVPS*AGDVERS186- 0.380.20
Tomm70amitochondrial import receptor subunit TOM70NP_997684AS*PALGSGPDGSGDSLEMSSLDRS94n/an/a
Tor1aip1torsin- 1A- interacting protein 1NP_659560LEQHSQQAQQQLS*PATSGRS142- 3.112.63
Tprtranslocated promoter regionNP_001100655TDGFAEAIHS*PQVAGVPRS2152- 0.300.16
Tra2atransformer- 2 protein homolog alphaNP_001119768HT*PTPGIYMGRT2000.000.04
Trim23GTP- binding protein ARD- 1NP_001094107MEIRVVT*LGLDGAGKT409n/an/a
Trim28transcription intermediary factor 1- betaNP_446368SRS*GEGEVSGLMRS4741.021.61
TtnPREDICTED: titinXP_001065955DT*STT*AWQIVSAT*VART22251^, T22254^, T22262^n/an/a
U2af2PREDICTED: U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2 isoform 6XP_001060115NRDQRSAS*RDRRRS55^1.583.18
Ubxn4UBX domain- containing protein 4NP_001012025NTELCET*PTTSDPKT156n/an/a
UgdhUDP- glucose 6- dehydrogenaseNP_112615RIPYT*PGEIPKT474- 0.270.12
Uhrf1E3 ubiquitin- protein ligase UHRF1NP_001008882KS*T*GPATT*SPRS696^, T697^, T702^n/an/a
UtrnutrophinNP_037202NVRPQPPT*SPEGRT14040.480.78
UtrnutrophinNP_037202NVRPQPPTS*PEGRS1405- 0.490.28
VclvinculinNP_001100718S*LLDASEEAIKKS721- 0.490.11*
Wbp11WW domain- binding protein 11NP_001009661RRDEDMLYS*PELAQRS237- 0.280.19
Wdr20aWD repeat domain 20aNP_001094364RNS*TDSRPVSVTYRS357- 2.831.99
Wdr20aWD repeat domain 20aNP_001094364SNS*LPHSAVSNAGSKS434- 0.822.15
Wdr20aWD repeat domain 20aNP_001094364SNSLPHS*AVSNAGSKS438^1.621.25
Xpo1exportin- 1NP_445942EKVY*IGKY126n/an/a
Zc3h18zinc finger CCCH domain- containing protein 18NP_958819VQSQEEIHS*DEEDQASEPKS63n/an/a
Zdhhc5probable palmitoyltransferase ZDHHC5NP_001034427GDS*LKEPTSIADSSRS3801.031.35
Zfp64zinc finger protein 64NP_001012093T*HMRT192- 2.281.65
ZfrPREDICTED: zinc finger RNA- binding proteinXP_345170RRDS*DGVDGFEAEGKS1027n/an/a
Znf574zinc finger protein 574NP_001019429KS*HVRNHLRS509n/an/a
Zranb2zinc finger Ran- binding domain- containing protein 2NP_113804ENVEYIEREES*DGEYDEFGRS120^n/an/a
Zranb2zinc finger Ran- binding domain- containing protein 2NP_113804EVEDKES*EGEEEDEDEDLSKS153n/an/a
Zranb2zinc finger Ran- binding domain- containing protein 2NP_113804YNLDAS*EEEDSNKS188n/an/a
ZyxzyxinNP_446213S*PGGPGPLTLKS336- 0.300.21